Proteintech, 31198-1-AP, KIAA1522 Polyclonal antibody

Size: 20ul / 150ul The KIAA1522 (31198-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA1522 in IHC, ELISA applications with reactivity to human samples 31198-1-AP targets KIAA1522 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information It is important to investigate the role of the big protein-coding gene KIAA1522. The mRNA expression of KIAA1522 was elevated in a number of malignancies, according to data from the Gene Expression Atlas and The European Bioinformatics Institute databases, which showed that abnormal KIAA1522 expression may have a role in the pathogenesis and growth of cancer. (PMID: 36761433) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35083 Product name: Recombinant human KIAA1522 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 900-1035 aa of NM_001198972 Sequence: EPRPPQSPASTASFIFSKGSRKLQLERPVSPETQADLQRNLVAELRSISEQRPPQAPKKSPKAPPPVARKPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQDRTKRELAENGGVLQLVGPEEKMGLPGSDSQKELA Predict reactive species Full Name: KIAA1522 Calculated Molecular Weight: 107 kDa GenBank Accession Number: NM_001198972 Gene Symbol: KIAA1522 Gene ID (NCBI): 57648 RRID: AB_3669896 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.