Proteintech, 31226-1-AP, COX19 Polyclonal antibody

Size: 20ul / 150ul The COX19 (31226-1-AP) by Proteintech is a Polyclonal antibody targeting COX19 in IHC, ELISA applications with reactivity to Human samples 31226-1-AP targets COX19 in IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35087 Product name: Recombinant human COX19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC103632 Sequence: MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEA Predict reactive species Full Name: COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) Calculated Molecular Weight: 90 aa, 10 kDa GenBank Accession Number: BC103632 Gene Symbol: COX19 Gene ID (NCBI): 90639 RRID: AB_3669908 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q49B96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.