Product Description
Size: 20ul / 150ul
The YARS (31228-1-AP) by Proteintech is a Polyclonal antibody targeting YARS in WB, IHC, ELISA applications with reactivity to human, pig samples
31228-1-AP targets YARS in WB, IHC, ELISA applications and shows reactivity with human, pig samples.
Tested Applications
Positive WB detected in: A431 cells, U2OS cells, pig pancreas tissue, pig tonsil tissue
Positive IHC detected in: human stomach cancer tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Background Information
Tyrosyl-tRNA synthetase (YARS) is responsible for tyrosyl-tRNA aminoacylation. The functional enzyme exists as a homodimer, has potent leukocyte and monocyte chemotaxis activity, and stimulates production of myeloperoxidase, tumor necrosis factor-α, and tissue factor. A shift in the monomer:dimer equilibrium could result in dysregulation of the cytokines function. (PMID: 33490854)
Specification
Tested Reactivity: human, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35148 Product name: Recombinant human YARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-528 aa of BC016689 Sequence: RTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS Predict reactive species
Full Name: tyrosyl-tRNA synthetase
Calculated Molecular Weight: 59 kDa
Observed Molecular Weight: 60 kDa
GenBank Accession Number: BC016689
Gene Symbol: YARS
Gene ID (NCBI): 8565
RRID: AB_3669909
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: P54577
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924