Proteintech, 31293-1-AP, TMEM189 Polyclonal antibody

Size: 20ul / 150ul The TMEM189 (31293-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM189 in IHC, ELISA applications with reactivity to human samples 31293-1-AP targets TMEM189 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TMEM189 (Plasmanylethanolamine desaturase 1), also known as PEDS1. It is predicted to be located in the endoplasmic reticulum membrane. Plasmalogens are glycerophospholipids with a hydrocarbon chain linked by a vinyl ether bond at the glycerol sn-1 position, and are involved in antioxidative and signaling mechanisms (PMID: 31604315). The molecular weight of TMEM189 is 31 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34323 Product name: Recombinant human TMEM189 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-270 aa of BC142966 Sequence: TNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK Predict reactive species Full Name: transmembrane protein 189 Observed Molecular Weight: 31 kDa GenBank Accession Number: BC142966 Gene Symbol: TMEM189 Gene ID (NCBI): 387521 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A5PLL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.