Proteintech, 31301-1-AP, EPS15 Polyclonal antibody

Size: 20ul / 150ul The EPS15 (31301-1-AP) by Proteintech is a Polyclonal antibody targeting EPS15 in WB, ELISA applications with reactivity to human samples 31301-1-AP targets EPS15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information EPS15 was originally identified as a substrate for the kinase activity of the epidermal growth factor receptor (EGFR). EPS15 has a tripartite structure comprising an NH2-terminal portion, which contains three EH domains, a central putative coiled-coil region, and a COOH-terminal domain containing multiple copies of the amino acid triplet Aspartate-Proline-Phenylalanine (PMID: 10481267). EPS15 is phosphorylated on tyrosine residues following EGFR activation (PMID: 7689153). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35282 Product name: Recombinant human EPS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 700-860 aa of NM_001981.3 Sequence: VVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAK Predict reactive species Full Name: epidermal growth factor receptor pathway substrate 15 Calculated Molecular Weight: 99 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_001981.3 Gene Symbol: EPS15 Gene ID (NCBI): 2060 RRID: AB_3669938 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P42566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.