Proteintech, 31327-1-AP, TMEM135 Polyclonal antibody

Size: 20ul / 150ul The TMEM135 (31327-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM135 in WB, ELISA applications with reactivity to human, mouse, rat samples 31327-1-AP targets TMEM135 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM135, also known as PMP52, contains 3 N-terminal transmembrane domains and 4 C-terminal transmembrane domains. TMEM135 is up-regulated in bone marrow-derived mesenchymal stem cells during differentiation into adipocytes compared to osteoblasts(PMID: 18637193). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34057 Product name: Recombinant human TMEM135 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 352-458 aa of BC051462 Sequence: YLASKLVETMYFKGIEAGKVPYFPHADTIIYSISTAICFQAAVMEVQTLRPSYWKFLLRLTKGKFAVMNRKVLDVFGTGASKHFQDFIPRLDPRYTTVTPELPTEFS Predict reactive species Full Name: transmembrane protein 135 Calculated Molecular Weight: 458 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC051462 Gene Symbol: TMEM135 Gene ID (NCBI): 65084 RRID: AB_3669944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86UB9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.