Proteintech, 31363-1-AP, DFNA5/GSDME Polyclonal antibody

Size: 20ul / 150ul The DFNA5/GSDME (31363-1-AP) by Proteintech is a Polyclonal antibody targeting DFNA5/GSDME in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 31363-1-AP targets DFNA5/GSDME in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, A549 cells, mouse brain tissue Positive IP detected in: SH-SY5Y cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DFNA5 (deafness, autosomal dominant 5), also known as GSDME or ICERE-1, is a 496 amino acid protein that is expressed in cochlea tissue, as well as in placenta, brain, heart, liver, lung and pancreas. Defects in the gene encoding DFNA5 are the cause of non-syndromic sensorineural deafness autosomal dominant type 5 (DFNA5), a form of sensorineural hearing loss that results from damage to one of various structures that receive sound information in the brain. GSDME produced two GSDME fragments with MW of 35 kDa and 25 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35186 Product name: Recombinant human DFNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-190 aa of BC019689 Sequence: NVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA Predict reactive species Full Name: deafness, autosomal dominant 5 Calculated Molecular Weight: 496 aa, 55 kDa Observed Molecular Weight: 55 kDa, 35 kDa, 25 kDa GenBank Accession Number: BC019689 Gene Symbol: DFNA5 Gene ID (NCBI): 1687 RRID: AB_3669957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60443 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.