Proteintech, 31383-1-AP, PRRC2C Polyclonal antibody

Size: 20ul / 150ul The PRRC2C (31383-1-AP) by Proteintech is a Polyclonal antibody targeting PRRC2C in WB, IF/ICC, ELISA applications with reactivity to human samples 31383-1-AP targets PRRC2C in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, K-562 cells, PC-3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35409 Product name: Recombinant human BAT2D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 881-1050 aa of BC006090 Sequence: DVRPHHTDANNQSACFEAPDQKTLSAPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEPIERPEEKPKKEGFIRSSEGPKPEKVYKSKSETRWGPRPSSNRREEVNDRPVRRSGPIKKPVLRDMKEEREQRKEKEGEKAEKVTEKVVVKP Predict reactive species Full Name: BAT2 domain containing 1 Observed Molecular Weight: 450 kDa GenBank Accession Number: BC006090 Gene Symbol: BAT2D1 Gene ID (NCBI): 23215 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.