Iright
BRAND / VENDOR: Proteintech

Proteintech, 31393-1-AP, GNG7 Polyclonal antibody

CATALOG NUMBER: 31393-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GNG7 (31393-1-AP) by Proteintech is a Polyclonal antibody targeting GNG7 in WB, ELISA applications with reactivity to Mouse, Rat samples 31393-1-AP targets GNG7 in WB, ELISA applications and shows reactivity with Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GNG7 belongs to the large guanine nucleotide binding protein γ family and is located on chromosome 19. Related genes of the G protein family are involved in various transmembrane signaling transduction pathways. GNG7 may be associated with transmembrane signaling pathways and involved in cell contact-induced growth arrest, thus repressing uncontrolled cell proliferation in multicellular organisms. GNG7 is a heterotrimeric G protein subunit with ubiquitous expression in various tissues but low expression in cancer. GNG7 overexpression inhibited cell growth and tumorigenicity of esophageal carcinoma cells. Also, GNG7 was confirmed as an essential autophagy-inducing agent and participated in inhibiting tumor progression through mTOR pathway (PMID: 30864685, 35281820, 36159963). Specification Tested Reactivity: Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34754 Product name: Recombinant human GNG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC014466 Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL Predict reactive species Full Name: guanine nucleotide binding protein (G protein), gamma 7 Calculated Molecular Weight: 8 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC014466 Gene Symbol: GNG7 Gene ID (NCBI): 2788 RRID: AB_3669962 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O60262 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924