Proteintech, 31394-1-AP, POLA1 Polyclonal antibody

Size: 20ul / 150ul The POLA1 (31394-1-AP) by Proteintech is a Polyclonal antibody targeting POLA1 in WB, ELISA applications with reactivity to human samples 31394-1-AP targets POLA1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35191 Product name: Recombinant human POLA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of NM_001330360 Sequence: MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPP Predict reactive species Full Name: polymerase (DNA directed), alpha 1, catalytic subunit Calculated Molecular Weight: 166 kDa Observed Molecular Weight: 190 kDa GenBank Accession Number: NM_001330360 Gene Symbol: POLA1 Gene ID (NCBI): 5422 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P09884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.