Proteintech, 31427-1-AP, C20orf26 Polyclonal antibody

Size: 20ul / 150ul The C20orf26 (31427-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf26 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31427-1-AP targets C20orf26 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C20orf26, also known as CFAP61 (cilia and flagella associated protein 61), is a protein-coding gene located on human chromosome 20. The protein is predicted to be involved in cilium movement and cilium organization, and it is likely to be located in the axoneme and motile cilium. CFAP61 is also predicted to colocalize with the radial spoke stalk, which is a part of the structural framework of cilia and flagella. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35425 Product name: Recombinant human C20orf26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-190 aa of BC031674 Sequence: HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE Predict reactive species Full Name: chromosome 20 open reading frame 26 GenBank Accession Number: BC031674 Gene Symbol: C20orf26 Gene ID (NCBI): 26074 RRID: AB_3669978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NHU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.