Proteintech, 31428-1-AP, INTS1 Polyclonal antibody

Size: 20ul / 150ul The INTS1 (31428-1-AP) by Proteintech is a Polyclonal antibody targeting INTS1 in WB, ELISA applications with reactivity to Human, mouse samples 31428-1-AP targets INTS1 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information INTS1 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35428 Product name: Recombinant human INTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-400 aa of BC069262 Sequence: GAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGS Predict reactive species Full Name: integrator complex subunit 1 Observed Molecular Weight: 250 kDa GenBank Accession Number: BC069262 Gene Symbol: INTS1 Gene ID (NCBI): 26173 RRID: AB_3669979 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N201 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.