Iright
BRAND / VENDOR: Proteintech

Proteintech, 31429-1-AP, SLC2A4RG Polyclonal antibody

CATALOG NUMBER: 31429-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC2A4RG (31429-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A4RG in WB, ELISA applications with reactivity to human samples 31429-1-AP targets SLC2A4RG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information SLC2A4RG, or SLC2A4 Regulator, is a nuclear transcription factor that plays a role in activating the solute carrier family 2 member 4 gene, also known as GLUT4. SLC2A4RG has been implicated in the transcriptional regulation of genes, including its interaction with a 7-bp consensus sequence (GCCGGCG), which is an essential cis-regulatory element for Huntington's disease (HD) gene expression in neuronal cells. The SLC2A4RG protein is involved in the modulation of SLC2A4 expression and has been identified as a transcription factor that binds specifically to the promoter region of SLC2A4. It is also known to interact with another transcription factor, myocyte enhancer factor 2 (MEF2), to activate the transcription of SLC2A4. SLC2A4RG is expressed ubiquitously in various tissues, with higher expression levels observed in fat and kidney tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35675 Product name: Recombinant human SLC2A4RG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-350 aa of NM_020062.3 Sequence: FQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASMPPAFPRLELPELLEPPALPSPLRPPAPPLPPPPVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTL Predict reactive species Full Name: SLC2A4 regulator Calculated Molecular Weight: 41kDa,387aa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_020062.3 Gene Symbol: SLC2A4RG Gene ID (NCBI): 56731 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NR83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924