Iright
BRAND / VENDOR: Proteintech

Proteintech, 31436-1-AP, SLC35B3 Polyclonal antibody

CATALOG NUMBER: 31436-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC35B3 (31436-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35B3 in WB, ELISA applications with reactivity to human samples 31436-1-AP targets SLC35B3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, MCF-7 cells, MDA-MB-231 cells, U2OS cells, MG-63 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information SLC35B3 (solute carrier family 35 member B3) is a member of the solute carrier family. SLC35B3 is involved in transporting 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. The observed MW of SLC35B3 is 40 kDa and 32 kDa, which is due to alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34349 Product name: Recombinant human SLC35B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC006973 Sequence: MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK Predict reactive species Full Name: solute carrier family 35, member B3 Calculated Molecular Weight: 401 aa, 45 kDa Observed Molecular Weight: 40, 32 kDa GenBank Accession Number: BC006973 Gene Symbol: SLC35B3 Gene ID (NCBI): 51000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H1N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924