Proteintech, 31437-1-AP, SLC8A2 Polyclonal antibody

Size: 20ul / 150ul The SLC8A2 (31437-1-AP) by Proteintech is a Polyclonal antibody targeting SLC8A2 in IHC, IF-P, ELISA applications with reactivity to human, rat samples 31437-1-AP targets SLC8A2 in IHC, IF-P, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat cerebellum tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC8A2, or solute carrier family 8 member 2, belongs to the SLC8 gene family, which encodes sodium-calcium exchangers (NCX). These proteins are part of the CaCA (Ca2+/Cation Antiporter) superfamily and play a significant role in regulating Ca2+-dependent events in many cell types. SLC8A2 has been implicated in various diseases, such as heart failure, arrhythmia, cerebral ischemia, hypertension, diabetes, and muscle dystrophy. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34438 Product name: Recombinant human SLC8A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-68 aa of NM_015063 Sequence: AATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDK Predict reactive species Full Name: solute carrier family 8 (sodium/calcium exchanger), member 2 Calculated Molecular Weight: 921 aa, 100 kDa GenBank Accession Number: NM_015063 Gene Symbol: SLC8A2 Gene ID (NCBI): 6543 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UPR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.