Iright
BRAND / VENDOR: Proteintech

Proteintech, 31438-1-AP, TMEM109 Polyclonal antibody

CATALOG NUMBER: 31438-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM109 (31438-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM109 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31438-1-AP targets TMEM109 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, HeLa cells, U-251 cells, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information TMEM109, also known as mg23 or mitsugumin-23, is a transmembrane protein localized to the sarcoplasmic/endoplasmic reticulum and nuclear membranes. TMEM109 is a ball-shaped cation channel in the sarcoplasmic reticulum (SR). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34866 Product name: Recombinant human TMEM109 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-243 aa of BC001309 Sequence: ILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSVEEE Predict reactive species Full Name: transmembrane protein 109 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC001309 Gene Symbol: TMEM109 Gene ID (NCBI): 79073 RRID: AB_3669983 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BVC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924