Iright
BRAND / VENDOR: Proteintech

Proteintech, 31459-1-AP, DAB1 Polyclonal antibody

CATALOG NUMBER: 31459-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DAB1 (31459-1-AP) by Proteintech is a Polyclonal antibody targeting DAB1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 31459-1-AP targets DAB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig cerebellum tissue, MCF-7 cells Positive IHC detected in: mouse cerebellum tissue, mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Disabled-1 (Dab1) is an adaptor protein that is essential for neuronal migration and maturation in response to the extracellular protein Reelin. DAB1 protein docks to the intracellular part of the Reelin very low density lipoprotein receptor and apoE receptor type 2 and becomes tyrosine-phosphorylated following binding of Reelin to cortical neurons. The DAB1 protein contains a 180-amino acid N-terminal protein interaction/phosphotyrosine-binding (PTB) 1 domain that docks to the short cytoplasmic tail of the very low density lipoprotein receptor or apoE receptor type 2 at the level of NPXY motifs, with a preference for unphosphorylated motifs. Dab1 polypeptide bands ranging from 36 to 120 kDa have been identified in mouse embryonic brain, the 80-kDa Dab1 being the predominant form (PMID: 24313315). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35376 Product name: Recombinant human DAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-280 aa of NM_021080 Sequence: KEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE Predict reactive species Full Name: disabled homolog 1 (Drosophila) Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 45 kDa, 80 kDa GenBank Accession Number: NM_021080 Gene Symbol: DAB1 Gene ID (NCBI): 1600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75553 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924