Proteintech, 31477-1-AP, ZNF185 Polyclonal antibody

Size: 20ul / 150ul The ZNF185 (31477-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF185 in WB, IF/ICC, ELISA applications with reactivity to human samples 31477-1-AP targets ZNF185 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, U2OS cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35743 Product name: Recombinant human ZNF185 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 193-400 aa of NM_007150.3 Sequence: HSYVLSAAKKSTGPTQETQAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGEEIVRLQILTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNVGSGATGSRPEGLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKAD Predict reactive species Full Name: zinc finger protein 185 (LIM domain) Calculated Molecular Weight: 74kDa，689aa Observed Molecular Weight: 74 kDa GenBank Accession Number: NM_007150.3 Gene Symbol: ZNF185 Gene ID (NCBI): 7739 RRID: AB_3665885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O15231 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.