Proteintech, 31487-1-AP, NHS Polyclonal antibody

Size: 20ul / 150ul The NHS (31487-1-AP) by Proteintech is a Polyclonal antibody targeting NHS in IHC, ELISA applications with reactivity to human samples 31487-1-AP targets NHS in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NHS (Nance-Horan syndrome protein), also named Actin remodeling regulator NHS, may function in cell morphology by maintaining the integrity of the circumferential actin ring and controlling lamellipod formation. Involved in the regulation eye, tooth, brain, and craniofacial development (PMID: 20332100). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34757 Product name: Recombinant human NHS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1532-1651 aa of BC136415 Sequence: YRMSATEILKSPILPKPPGELTAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSST Predict reactive species Full Name: Nance-Horan syndrome (congenital cataracts and dental anomalies) GenBank Accession Number: BC136415 Gene Symbol: NHS Gene ID (NCBI): 4810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6T4R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.