Iright
BRAND / VENDOR: Proteintech

Proteintech, 31490-1-AP, FAT2 Polyclonal antibody

CATALOG NUMBER: 31490-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAT2 (31490-1-AP) by Proteintech is a Polyclonal antibody targeting FAT2 in WB, ELISA applications with reactivity to human samples 31490-1-AP targets FAT2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FAT2 (FAT atypical cadherin 2), also known as CDHF8. The gene product is a member of the cadherin superfamily, a group of integral membrane proteins characterized by the presence of cadherin-type repeats. This protein most likely functions as a cell adhesion molecule, controlling cell proliferation and playing an important role in cerebellum development. Expressed in epidermal keratinocytes, infant brain, cerebellum, and also in a variety of tumors, such as pancreatic cancer, diffuse type gastric cancer, ovarian cancer, esophageal cancer, skin squamous cell carcinoma, head and neck cancer. Not expressed in melanoma cell line A375 cells, normal epidermal melanocytes or normal dermal fibroblasts. Expressed in epidermal keratinocytes and squamous cell carcinoma (at protein level). The molecular weight of FAT2 is 473 kDa. The huge molecular masses (about 500-600 kDa) have hindered studies of the molecular aspects of itself roles(PMID: 15923647). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34942 Product name: Recombinant human FAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-400 aa of NM_001447 Sequence: SGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLAALVVHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDPGKHFKAIKSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSLKFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPNLQYVLKPS Predict reactive species Full Name: FAT tumor suppressor homolog 2 (Drosophila) Calculated Molecular Weight: 479 kDa Observed Molecular Weight: 500-600 kDa GenBank Accession Number: NM_001447 Gene Symbol: FAT2 Gene ID (NCBI): 2196 RRID: AB_3670004 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NYQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924