Iright
BRAND / VENDOR: Proteintech

Proteintech, 31492-1-AP, DNAJC13 Polyclonal antibody

CATALOG NUMBER: 31492-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DNAJC13 (31492-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC13 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 31492-1-AP targets DNAJC13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DNAJC13 is a large protein with 2,243 amino acids. Due to the presence of the central DNAJ domain, DNAJC13 binds HSC70 (heat shock cognate 70) and acts as a co-chaperone in mediating HSC70 cellular functions. Within the cell, DNAJC13 is primarily localized at membranous structures. This interaction is mediated, at least in part, by the binding to phosphoinositides (PI) through its N-terminal sequence. RME-8/DNAJC13 is involved in several endosomal functions such as protein sorting, endosomal tubulation, transport processes including the retrograde transport from the endosome to the trans-Golgi network (TGN), the formation of endosomal degradative microdomains, and the recycling of membrane receptors. (PMID: 32322926) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35412 Product name: Recombinant human DNAJC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1300-1400 aa of BC043583 Sequence: DDAYEVLNLPQGQGPHDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIR Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 13 Observed Molecular Weight: 254 kDa GenBank Accession Number: BC043583 Gene Symbol: DNAJC13 Gene ID (NCBI): 23317 RRID: AB_3670005 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75165 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924