Proteintech, 31508-1-AP, Chemerin Polyclonal antibody

Size: 20ul / 150ul The Chemerin (31508-1-AP) by Proteintech is a Polyclonal antibody targeting Chemerin in WB, ELISA applications with reactivity to mouse, rat samples 31508-1-AP targets Chemerin in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Chemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0875 Product name: Recombinant mouse Chemerin protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-156 aa of NM_001347168.1 Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS Predict reactive species Full Name: retinoic acid receptor responder (tazarotene induced) 2 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 14-19 kDa GenBank Accession Number: NM_001347168.1 Gene Symbol: Chemerin Gene ID (NCBI): 71660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9DD06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.