Iright
BRAND / VENDOR: Proteintech

Proteintech, 31514-1-AP, CD9 Polyclonal antibody

CATALOG NUMBER: 31514-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD9 (31514-1-AP) by Proteintech is a Polyclonal antibody targeting CD9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31514-1-AP targets CD9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, L02 cells Positive IHC detected in: human breast cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD9, also known as Tspan-29, p24 or MIC3, is a member of the tetraspanin superfamily (PMID: 1879540). It is expressed on a large variety of hematopoietic and non-hematopoietic cells, such as stromal cells, megakaryocytes, platelets, B and T lymphocytes, dendritic cells, endothelial cells, mast cells, eosinophils, and basophils (PMID: 30356731). CD9 interacts with the integrin family and other membrane proteins, and is involved in cell adhesion, cell motility and tumor metastasis (PMID: 8478605; 21428940; 25805926). Expression of CD9 enhances membrane fusion between muscle cells and supports myotube maintenance (PMID:10459022). On oocytes, CD9 is hypothesized to play a role in fertilization of mammals (PMID: 25536312). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species Full Name: CD9 molecule Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: NM_001769.4 Gene Symbol: CD9 Gene ID (NCBI): 928 RRID: AB_3670013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P21926 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924