Iright
BRAND / VENDOR: Proteintech

Proteintech, 31516-1-AP, Cathepsin D Polyclonal antibody

CATALOG NUMBER: 31516-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cathepsin D (31516-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin D in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31516-1-AP targets Cathepsin D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, HuH-7 cells, MCF-7 cells Positive IHC detected in: human ovary cancer tissue, human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CTSD (cathepsin D) is a lysosomal aspartic protease in the pepsin superfamily ubiquitous to all cell types but particularly abundant in the central nervous system (CNS). The signal peptide of the pre-proCTSD (52 kDa) is cleaved in the endoplasmic reticulum (ER), forming the pro-CTSD (48 kDa), finally processed to form the mature CTSD (32 kDa) in the lysosome (PMID: 31282275,15126630). The major role of the m-CTSD is the digestion of internalized waste cell proteins and peptides in the lysosome, which maintains cell health (PMID: 32324083). CTSD is a well-established aspartyl protease that functions intracellularly in lysosomes and extracellularly in several forms of cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg1053 Product name: Recombinant Human Cathepsin D protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-412 aa of NM_001909.5 Sequence: LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL Predict reactive species Full Name: cathepsin D Calculated Molecular Weight: 45kDa Observed Molecular Weight: 32 kDa, 48 kDa, 52 kDa GenBank Accession Number: NM_001909.5 Gene Symbol: Cathepsin D Gene ID (NCBI): 1509 RRID: AB_3670015 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P07339 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924