Proteintech, 31523-1-AP, EXOC8 Polyclonal antibody

Size: 20ul / 150ul The EXOC8 (31523-1-AP) by Proteintech is a Polyclonal antibody targeting EXOC8 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31523-1-AP targets EXOC8 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EXOC8 is a subunit of the exocyst complex involved in docking exocytic vesicles with fusion sites on the plasma membrane. Truncated EXOC8 protein leads to the improper assembly of the exocyst complex, thus resulting in the accumulation of neurotransmitters and other excretory vesicles in the cell. It is found to play an essential role in normal cortical development and its perturbation causes complex brain disorders. EXOC8 mutations are linked to neurodevelopmental disorders with microcephaly, seizures, and brain atrophy (PMID: 35460391, PMID: 36344539). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33300 Product name: Recombinant human EXOC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 564-725 aa of BC035763 Sequence: EATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPESTTSVV Predict reactive species Full Name: exocyst complex component 8 Calculated Molecular Weight: 725 aa, 82 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC035763 Gene Symbol: EXOC8 Gene ID (NCBI): 149371 RRID: AB_3670020 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IYI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.