Iright
BRAND / VENDOR: Proteintech

Proteintech, 31535-1-AP, HERC1 Polyclonal antibody

CATALOG NUMBER: 31535-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HERC1 (31535-1-AP) by Proteintech is a Polyclonal antibody targeting HERC1 in WB, ELISA applications with reactivity to human samples 31535-1-AP targets HERC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33624 Product name: Recombinant human HERC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 591-890 aa of NM_003922 Sequence: NGKLGHGDTNRVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIEELAATRIVDVSIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAIQQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLPFPSSREHHSFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQEVVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIIL* Predict reactive species Full Name: hect (homologous to the E6-AP (UBE3A) carboxyl terminus) domain and RCC1 (CHC1)-like domain (RLD) 1 Calculated Molecular Weight: 532 kDa Observed Molecular Weight: 532-550 kDa GenBank Accession Number: NM_003922 Gene Symbol: HERC1 Gene ID (NCBI): 8925 RRID: AB_3670025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924