Product Description
Size: 20ul / 150ul
The LMTK2 (31540-1-AP) by Proteintech is a Polyclonal antibody targeting LMTK2 in WB, ELISA applications with reactivity to human, mouse samples
31540-1-AP targets LMTK2 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, U2OS cells, BV-2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
Lemur tyrosine kinase 2 (LMTK2) is a transmembrane protein with serine and threonine but not tyrosine kinase activity.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35620 Product name: Recombinant human LMTK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1371-1503 aa of BC131504 Sequence: TPTKELGPCGGEACGPDLSGPAPASGSPYLSRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSRFSISPANIASFSLTHLTDSDIEQGGSSEDGEKD Predict reactive species
Full Name: lemur tyrosine kinase 2
Observed Molecular Weight: 250 kDa
GenBank Accession Number: BC131504
Gene Symbol: LMTK2
Gene ID (NCBI): 22853
RRID: AB_3670029
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q8IWU2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924