Proteintech, 31541-1-AP, TANC2 Polyclonal antibody

Size: 20ul / 150ul The TANC2 (31541-1-AP) by Proteintech is a Polyclonal antibody targeting TANC2 in WB, IF/ICC, ELISA applications with reactivity to human samples 31541-1-AP targets TANC2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Tetratricopeptide repeat, ankyrin repeat, and coiled-coil containing 2 (TANC2), also known as KIAA1148 and KIAA1636, belongs to the TANC family. TANC2 is a large 220 kDa protein consisting of 1990 amino acid residues. Named after its domain architecture, it comprises tetratricopeptide (TPR) and ankyrin repeats (ANK), a coiled-coil domain, and a C-terminal PDZ-interacting motif. TANC2 is widely expressed in the developing human (in excitatory neurons and radial glial cells) and rodent brain as well as in the adult brain as a scaffold in the postsynaptic density (PSD) of excitatory neurons. As such, it facilitates cell signaling downstream of cell surface glutamate receptors through multi-protein complex formation with other PSD proteins (e.g. PSD95, SHANK1), influencing dendritic spine formation and synaptic strength (PMID: 33976205, 34964047). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35427 Product name: Recombinant human TANC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1815-1990 aa of NM_001394998 Sequence: AYERSCDELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDYYSPHGMLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQDNLYRQLSRDSRQGQTSPIKPKRPFVESNV Predict reactive species Full Name: tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2 Calculated Molecular Weight: 219kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: NM_001394998 Gene Symbol: TANC2 Gene ID (NCBI): 26115 RRID: AB_3670030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9HCD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.