Proteintech, 31542-1-AP, AKAP8 Polyclonal antibody

Size: 20ul / 150ul The AKAP8 (31542-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP8 in WB, ELISA applications with reactivity to Human samples 31542-1-AP targets AKAP8 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HL-60 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information AKAP8 (A-kinase anchor protein 8), also called AKAP95, is a A-kinase anchor protein that directs activity of protein kinase A by tethering the enzyme near its physiologic substrates (PMID: 9473338; 10601332). It is associated with chromatin and nuclear matrix which has a remarkable activity in promoting chromatin transcription (PMID: 31980632), and it is also required for cell cycle G2/M transition and histone deacetylation during mitosis (PMID: 16980585). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35816 Product name: Recombinant human AKAP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 501-692 aa of NM_005858.3 Sequence: SVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE Predict reactive species Full Name: A kinase (PRKA) anchor protein 8 Calculated Molecular Weight: 76kDa，692aa Observed Molecular Weight: 95 kDa GenBank Accession Number: NM_005858.3 Gene Symbol: AKAP8 Gene ID (NCBI): 10270 RRID: AB_3670031 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O43823 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.