Iright
BRAND / VENDOR: Proteintech

Proteintech, 31543-1-AP, PPEF2 Polyclonal antibody

CATALOG NUMBER: 31543-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PPEF2 (31543-1-AP) by Proteintech is a Polyclonal antibody targeting PPEF2 in WB, ELISA applications with reactivity to human, mouse, rat samples 31543-1-AP targets PPEF2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Pprotein phosphatase with EF-hand domain 2 (PPEF2), also known as PPP7CB, is a member of the serine/threonine protein phosphatase with EF-hand motif family. PPEF2 can dephosphorylate ubiquitin and suppress PINK1-dependent mitophagy. PPEF2 functions to suppress mitochondrial quality control on a cellular level through dephosphorylation of p-S65 ubiquitin. PPEF2 exists 2 isoforms produced by alternative splicing with a molecular weight of 86 kDa (PPEF-2(L)) and 69 kDa (PPEF-2(S)). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35922 Product name: Recombinant human PPEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-442 aa of NM_006239 Sequence: GVSDITDLELLDKIERSKIVSTMRCKTRQKSEKQMEEKRRANQKSSAQGPIPWFLPESRSLPSSPLRLGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELELERCRQQAGLLVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVV Predict reactive species Full Name: protein phosphatase, EF-hand calcium binding domain 2 Calculated Molecular Weight: 86kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: NM_006239 Gene Symbol: PPEF2 Gene ID (NCBI): 5470 RRID: AB_3670032 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O14830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924