Proteintech, 31624-1-AP, EFHD2 Polyclonal antibody

Size: 20ul / 150ul The EFHD2 (31624-1-AP) by Proteintech is a Polyclonal antibody targeting EFHD2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 31624-1-AP targets EFHD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, NCI-H1299 cells, SW480 cells, Calu-1 cells, HCT 116 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EF-hand domain-containing protein D2 (also known as Swiprosin-1) is a calcium-binding protein with two conserved EF-chiral coiled-coil structural domains, and it is mostly involved in calcium signaling, cytoskeleton assembly and synapse formation. EFHD2 is broadly expressed in various cell types, with particularly high expression in neurons. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35084 Product name: Recombinant human EFHD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-80 aa of BC023611 Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF Predict reactive species Full Name: EF-hand domain family, member D2 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC023611 Gene Symbol: EFHD2 Gene ID (NCBI): 79180 RRID: AB_3670053 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96C19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.