Proteintech, 31625-1-AP, TMEM164 Polyclonal antibody

Size: 20ul / 150ul The TMEM164 (31625-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM164 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31625-1-AP targets TMEM164 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TMEM164 (Transmembrane Protein 164) is a membrane protein with significant roles in various biological processes, including lipid metabolism, neuroprotection, and cancer regulation. In non-small cell lung cancer (NSCLC), TMEM164 promotes ferroptosis by mediating autophagy, leading to the degradation of ferritin, GPX4, and lipid droplets, which facilitates iron accumulation and lipid peroxidation (PMID: 39798196). In neurodegenerative diseases, TMEM164 overexpression via gene therapy shows promise in reducing neurotoxic reactive astrocyte activation and alleviating disease symptoms (PMID: 37679556). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34317 Product name: Recombinant human TMEM164 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-38 aa of BC085605 Sequence: MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR Predict reactive species Full Name: transmembrane protein 164 GenBank Accession Number: BC085605 Gene Symbol: TMEM164 Gene ID (NCBI): 84187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5U3C3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.