Iright
BRAND / VENDOR: Proteintech

Proteintech, 31626-1-AP, OATP1A2 Polyclonal antibody

CATALOG NUMBER: 31626-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The OATP1A2 (31626-1-AP) by Proteintech is a Polyclonal antibody targeting OATP1A2 in WB, ELISA applications with reactivity to human, mouse, rat samples 31626-1-AP targets OATP1A2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human heart tissue, mouse heart tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SLCO1A2 also known as OATP1A2, is a member of the SLC21A family of solute carriers. SLCO1A2 encodes a sodium-independent transporter that mediates cellular uptake of organic ions in the liver(PMID: 19129463). It has been reported that SLCO1A2 detected a nonglycosylated form around 59kDa and 70-75 kDa glycosylated form(PMID: 15632119). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34497 Product name: Recombinant human SLCO1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-513 aa of NM_021094 Sequence: FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF Predict reactive species Full Name: solute carrier organic anion transporter family, member 1A2 Calculated Molecular Weight: 670 aa, 74 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_021094 Gene Symbol: SLCO1A2 Gene ID (NCBI): 6579 RRID: AB_3670054 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P46721 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924