Proteintech, 31633-1-AP, NPEPPS Polyclonal antibody

Size: 20ul / 150ul The NPEPPS (31633-1-AP) by Proteintech is a Polyclonal antibody targeting NPEPPS in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 31633-1-AP targets NPEPPS in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NPEPPS, also known as PSA, is a member of the oxytocinase subfamily of the M1 aminopeptidase family. NPEPPS encodes puromycin-sensitive aminopeptidase, a zinc metallopeptidase that hydrolyzes amino acids from the N-terminus of its substrate. The protein has 2 isoforms and is located in the cytoplasm. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36035 Product name: Recombinant human NPEPPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-919 aa of BC065294 Sequence: GKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV Predict reactive species Full Name: aminopeptidase puromycin sensitive Observed Molecular Weight: 103 kDa GenBank Accession Number: BC065294 Gene Symbol: NPEPPS Gene ID (NCBI): 9520 RRID: AB_3670057 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P55786 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.