Iright
BRAND / VENDOR: Proteintech

Proteintech, 31680-1-AP, CCDC151 Polyclonal antibody

CATALOG NUMBER: 31680-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC151 (31680-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC151 in WB, ELISA applications with reactivity to human, mouse, rat samples 31680-1-AP targets CCDC151 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CCDC151 (Coiled-coil domain-containing protein 151), also called ODAD3 (Outer dynein arm-docking complex subunit 3), is a component of the outer dynein arm-docking complex (ODA-DC) that mediates outer dynein arms (ODA) binding onto the doublet microtubule (PMID: 25192045). It is involved in mediating the assembly of both ODAs and their axonemal docking complex onto ciliary microtubules (PMID: 25192045). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34867 Product name: Recombinant human CCDC151 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-595 aa of BC141828 Sequence: NRLDSMEAEVVRTKHELEALHVVNQEALNARDIAKNQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRWSMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSGEATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDPQADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS Predict reactive species Full Name: coiled-coil domain containing 151 Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC141828 Gene Symbol: CCDC151 Gene ID (NCBI): 115948 RRID: AB_3670074 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A5D8V7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924