Iright
BRAND / VENDOR: Proteintech

Proteintech, 31686-1-AP, ALAD Polyclonal antibody

CATALOG NUMBER: 31686-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ALAD (31686-1-AP) by Proteintech is a Polyclonal antibody targeting ALAD in WB, ELISA applications with reactivity to human samples 31686-1-AP targets ALAD in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information Delta-aminolevulinic acid dehydratase (ALAD) is also named as Porphobilinogen synthase. ALAD, encoded by the moonlighting gene ALAD, not only participates in the second step of heme biosynthesis, but also inhibits the 26S proteasome (PMID: 35318110). ALAD is involved in tumor progression. For example, ALAD2 allele (ALAD polymorphism) is related to an increased risk for meningioma, and downregulation of ALAD is related to poor prognosis of patients with breast cancer (PMID: 16140629, PMID: 28403546). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35649 Product name: Recombinant human ALAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-330 aa of NM_000031.5 Sequence: AEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE Predict reactive species Full Name: aminolevulinate, delta-, dehydratase Calculated Molecular Weight: 36kDa,330aa Observed Molecular Weight: 36-39 kDa GenBank Accession Number: NM_000031.5 Gene Symbol: ALAD Gene ID (NCBI): 210 RRID: AB_3670079 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P13716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924