Proteintech, 31695-1-AP, Talin-2 Polyclonal antibody

Size: 20ul / 150ul The Talin-2 (31695-1-AP) by Proteintech is a Polyclonal antibody targeting Talin-2 in WB, ELISA applications with reactivity to human samples 31695-1-AP targets Talin-2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Talin is a macromolecular cytoskeleton protein located on the extracellular matrix (ECM) that can bind to a variety of adhesion molecules (e.g., integrin, actin, and adhesion kinase).Humans have two Talin genes, TLN1 and TLN2, which encode Talin 1 and Talin 2 proteins respectively. TLN2 has 74% homology with TLN1 . Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36217 Product name: Recombinant human TLN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1140-1313 aa of NM_015059 Sequence: VAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMA Predict reactive species Full Name: talin 2 Calculated Molecular Weight: 271kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_015059 Gene Symbol: TLN2 Gene ID (NCBI): 83660 RRID: AB_3670082 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y4G6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.