Iright
BRAND / VENDOR: Proteintech

Proteintech, 31700-1-AP, CWF19L1 Polyclonal antibody

CATALOG NUMBER: 31700-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CWF19L1 (31700-1-AP) by Proteintech is a Polyclonal antibody targeting CWF19L1 in WB, ELISA applications with reactivity to human samples 31700-1-AP targets CWF19L1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CWF19L1 belongs to the CWF19 family. CWF19L1 includes a metallophosphatase (MMP) domain, a histidine triad motif (HIT) domain, and a C-terminal Cwf-J-C domain. CWF19L1 is believed to be involved in cell cycle control, endosomal trafficking, and mRNA processing. CWF19L1 is a rare cause of autosomal recessive cerebellar ataxias (ARCA) (PMID: 36357319, PMID: 36453471). CWF19L1 is expressed in many brain regions, including cerebellum, thalamus and occipital, parietal and temporal lobes. CWF19L1 is also expressed in the spinal cord (PMID: 25361784). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36356 Product name: Recombinant human CWF19L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 325-538 aa of BC008746 Sequence: PGPCWFCLASPEVEKHLVVNIGTHCYLALAKGGLSDDHVLILPIGHYQSVVELSAEVVEEVEKYKATLRRFFKSRGKWCVVFERNYKSHHLQLQVIPVPISCSTTDDIKDAFITQAQEQQIELLEIPEHSDIKQIAQPGAAYFYVELDTGEKLFHRIKKNFPLQFGREVLASEAILNVPDKSDWRQCQISKEDEETLARRFRKDFEPYDFTLDD Predict reactive species Full Name: CWF19-like 1, cell cycle control (S. pombe) Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC008746 Gene Symbol: CWF19L1 Gene ID (NCBI): 55280 RRID: AB_3670086 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q69YN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924