Iright
BRAND / VENDOR: Proteintech

Proteintech, 31702-1-AP, CDK5RAP2 Polyclonal antibody

CATALOG NUMBER: 31702-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDK5RAP2 (31702-1-AP) by Proteintech is a Polyclonal antibody targeting CDK5RAP2 in WB, ELISA applications with reactivity to human samples 31702-1-AP targets CDK5RAP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Cyclin-dependent kinase 5 regulatory subunit associated protein 2 (CDK5RAP2) is a pericentriolar matrix (PCM) protein that regulates centriole engagement and centrosome cohesion during the cell cycle. CDK5RAP2 is associated with several cancers, including breast cancer, oral squamous cell carcinoma and haematological malignancies. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36245 Product name: Recombinant human CDK5RAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1221-1571 aa of BC146782 Sequence: MQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQIKDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMVNSFSQDLLMEHIQEIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGSRDKQKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEELKLRQQLLSQNDKLLQSLRVELKAYEKLDEEH Predict reactive species Full Name: CDK5 regulatory subunit associated protein 2 Calculated Molecular Weight: 1893 aa, 215 kDa Observed Molecular Weight: 210-215 kDa GenBank Accession Number: BC146782 Gene Symbol: CDK5RAP2 Gene ID (NCBI): 55755 RRID: AB_3670087 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96SN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924