Iright
BRAND / VENDOR: Proteintech

Proteintech, 31710-1-AP, CAB39 Polyclonal antibody

CATALOG NUMBER: 31710-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CAB39 (31710-1-AP) by Proteintech is a Polyclonal antibody targeting CAB39 in WB, ELISA applications with reactivity to human, rat samples 31710-1-AP targets CAB39 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CAB39 (Calcium-binding protein 39), also called MO25, is a component of the complex that binds and activates STK11/LKB1. It is required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (PMID: 19892943). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36153 Product name: Recombinant human CAB39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC020570 Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMK Predict reactive species Full Name: calcium binding protein 39 Observed Molecular Weight: 39-40 kDa GenBank Accession Number: BC020570 Gene Symbol: CAB39 Gene ID (NCBI): 51719 RRID: AB_3670091 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y376 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924