Iright
BRAND / VENDOR: Proteintech

Proteintech, 31730-1-AP, PDE4B Polyclonal antibody

CATALOG NUMBER: 31730-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PDE4B (31730-1-AP) by Proteintech is a Polyclonal antibody targeting PDE4B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31730-1-AP targets PDE4B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information PDE4B, also known as DPDE4, is a member of the PDE family of type IV cAMP-specific cyclic nucleotides. PDE4B regulates the cellular concentration of cyclic nucleotides and thus plays a role in signal transduction of inflammatory factors. Among all subtypes of PDE4, PDE4B is closely associated with cancer and has a major contribution to the role in hematological malignancies. PDE4B is distributed in multiple tissues, especially myeloid cells (PMID: 35899614, PMID: 36278172). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35552 Product name: Recombinant human PDE4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-736 aa of BC105040 Sequence: WYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT Predict reactive species Full Name: phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) Calculated Molecular Weight: 736 aa, 83 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC105040 Gene Symbol: PDE4B Gene ID (NCBI): 5142 RRID: AB_3670101 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q07343 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924