Proteintech, 31739-1-AP, NT5DC2 Polyclonal antibody

Size: 20ul / 150ul The NT5DC2 (31739-1-AP) by Proteintech is a Polyclonal antibody targeting NT5DC2 in WB, ELISA applications with reactivity to human samples 31739-1-AP targets NT5DC2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information 5'-Nucleotidase domain containing 2 (NT5DC2) is a member of the NT5DC family and contains a haloacid dehalogenase motif localized in the N-terminus of these proteins (PMID: 32962856). NT5DC2 is associated with attention-deficit/hyperactivity disorder and bipolar disorder. NT5DC2 has been shown to interact with and stabilize Fyn, a Src family proto-oncogene, and plays a role in regulating glioblastoma progression. NT5DC2 promotes tumor cell proliferation by stabilizing EGFR in hepatocellular carcinoma (PMID: 32382041). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35015 Product name: Recombinant human NT5DC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 195-265 aa of NM_022908 Sequence: LLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLF Predict reactive species Full Name: 5'-nucleotidase domain containing 2 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: NM_022908 Gene Symbol: NT5DC2 Gene ID (NCBI): 64943 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H857 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.