Iright
BRAND / VENDOR: Proteintech

Proteintech, 31740-1-AP, MDFIC Polyclonal antibody

CATALOG NUMBER: 31740-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MDFIC (31740-1-AP) by Proteintech is a Polyclonal antibody targeting MDFIC in IF/ICC, IP, ELISA applications with reactivity to human samples 31740-1-AP targets MDFIC in IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Kasumi-1 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MDFIC encodes the MyoD family inhibitor domain containing protein, a 246-amino acid protein documented to regulate the activity of transcription factors including the glucocorticoid recep tor (GR), HAND1, and T cell factor/lymphoid enhancer factor (TCF/LEF) family members. The C-terminal region of MDFIC harbors a domain extremely rich in cysteine residues, reported to mediate protein-protein interactions between MDFIC and transcription factor componentry (PMID: 35235341). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35437 Product name: Recombinant human MDFIC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of NM_001166345 Sequence: MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSDISKKSKVNAVFSQKTGSSPEDCCVHC Predict reactive species Full Name: MyoD family inhibitor domain containing Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: NM_001166345 Gene Symbol: MDFIC Gene ID (NCBI): 29969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P1T7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924