Iright
BRAND / VENDOR: Proteintech

Proteintech, 31743-1-AP, KBTBD6 Polyclonal antibody

CATALOG NUMBER: 31743-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KBTBD6 (31743-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD6 in WB, ELISA applications with reactivity to human samples 31743-1-AP targets KBTBD6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Saos-2 cells, TT cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KBTBD6 (Kelch repeat and BTB domain-containing protein 6) is involved in proteasome-mediated ubiquitin-dependent protein catabolic process; protein K48-linked ubiquitination; and Rac protein signal transduction regulation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36046 Product name: Recombinant human KBTBD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 625-674 aa of BC000560 Sequence: PGQSFLTEEEEIPSESSTEWDLGGFSEPDSESGSSSSLSDDDFWVRVAPQ Predict reactive species Full Name: kelch repeat and BTB (POZ) domain containing 6 Observed Molecular Weight: 76 kDa GenBank Accession Number: BC000560 Gene Symbol: KBTBD6 Gene ID (NCBI): 89890 RRID: AB_3670103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86V97 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924