Proteintech, 31745-1-AP, CD11b Polyclonal antibody

Size: 20ul / 150ul The CD11b (31745-1-AP) by Proteintech is a Polyclonal antibody targeting CD11b in WB, IF/ICC, ELISA applications with reactivity to mouse samples 31745-1-AP targets CD11b in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells Positive IF/ICC detected in: RAW 264.7 cells, BV-2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). CD11b, also known as Integrin alpha M or CR3A, belongs to the integrin alpha chain family. CD11b forms an α/β heterodimer with CD18 (integrin β2). CD11b/CD18 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PMID: 9558116; 20008295). CD11b/CD18 is a receptor for the complement protein fragment iC3b, and is also a receptor for fibrinogen, factor X and ICAM1 (PMID: 2971974; 15485828). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36145 Product name: Recombinant mouse Itgam protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 925-1105 aa of BC156991 Sequence: AIYMIVTSDESSIRYLNFTASEMTSKVIQHQYQFNNLGQRSLPVSVVFWIPVQINNVTVWDHPQVIFSQNLSSACHTEQKSPPHSNFRDQLERTPVLNCSVAVCKRIQCDLPSFNTQEIFNVTLKGNLSFDWYIKTSHGHLLLVSSTEILFNDSAFALLPGQESYVRSKTETKVEPYEVHN Predict reactive species Full Name: integrin alpha M Calculated Molecular Weight: 127 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC156991 Gene Symbol: CD11b Gene ID (NCBI): 16409 RRID: AB_3670104 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: E9Q604 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.