Proteintech, 31753-1-AP, HBG2 Polyclonal antibody

Size: 20ul / 150ul The HBG2 (31753-1-AP) by Proteintech is a Polyclonal antibody targeting HBG2 in WB, ELISA applications with reactivity to human samples 31753-1-AP targets HBG2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, TF-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The gamma globin genes (HBG2, encoding Gγ-globin; HBG1 encoding Aγ-globin) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. Gamma chain production continues into adulthood in some beta-thalassemias and related conditions. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36028 Product name: Recombinant human HBG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC029387 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLS Predict reactive species Full Name: hemoglobin, gamma G Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 14~16 kDa GenBank Accession Number: BC029387 Gene Symbol: HBG2 Gene ID (NCBI): 3048 RRID: AB_3670105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P69892 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.