Iright
BRAND / VENDOR: Proteintech

Proteintech, 31759-1-AP, MEIKIN Polyclonal antibody

CATALOG NUMBER: 31759-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MEIKIN (31759-1-AP) by Proteintech is a Polyclonal antibody targeting MEIKIN in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 31759-1-AP targets MEIKIN in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF/ICC detected in: MDCK cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Meikin is a conservative regulatory protein that plays a key role in meiosis. It was first discovered in mice. It is a meiotic-specific centromere protein and was named Meikin because of its important role in meiosis. Meikin's function is mainly realized by regulating the activity of Polo-like kinase PLK1. PLK1 is enriched to centromere under Meikin's dependence, which further affects the function of centromere. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36937 Product name: Recombinant human MEIKIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of NM_001303622 Sequence: MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRLGVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSE Predict reactive species Full Name: similar to mCG13783 Calculated Molecular Weight: 373aa, 41 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_001303622 Gene Symbol: LOC728637 Gene ID (NCBI): 728637 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: A0A087WXM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924