Proteintech, 31766-1-AP, Osteoprotegerin/TNFRSF11B Polyclonal antibody

Size: 20ul / 150ul The Osteoprotegerin/TNFRSF11B (31766-1-AP) by Proteintech is a Polyclonal antibody targeting Osteoprotegerin/TNFRSF11B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31766-1-AP targets Osteoprotegerin/TNFRSF11B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Osteoprotegerin (OPG), also known as tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) and osteoclastogenesis inhibitory factor (OCIF), belongs to the tumor necrosis factor (TNF) receptor superfamily. By binding to RANKL, OPG inhibits osteoclastic activity and promotes bone formations. OPG plays a key role on cell survival by inhibiting TRAIL-induced apoptosis. OPG also is involved in vascular biology, fibrosis, immunity, EMT, and the apoptosis of cancer cells (PMID: 35523775). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0976 Product name: Recombinant Human Osteoprotegerin/TNFRSF11B protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-401 aa of NM_002546.4 Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 11b Calculated Molecular Weight: 46kDa Observed Molecular Weight: 56-60 kDa GenBank Accession Number: NM_002546.4 Gene Symbol: TNFRSF11B Gene ID (NCBI): 4982 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00300 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.