Proteintech, 31784-1-AP, ENGASE Polyclonal antibody

Size: 20ul / 150ul The ENGASE (31784-1-AP) by Proteintech is a Polyclonal antibody targeting ENGASE in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31784-1-AP targets ENGASE in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissue, mouse thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Endo-β-N-acetylglucosaminidase (ENGASE) is an enzyme that belongs to glycoside hydrolase (GH) families 18 and 85, and is widely distributed in bacteria, fungi, and higher-order species. ENGASE hydrolyzes the β1-4 linkage of the N, N-diacetylchitobiose (GlcNAcβ1-4GlcNAc) region of the N-linked glycans present on glycoproteins (PMID: 36435009). ENGASE is widely expressed, with higher expression in thymus and spleen (Refer to Uniprot). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34633 Product name: Recombinant human ENGASE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-200 aa of NM_001042573 Sequence: IKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGR Predict reactive species Full Name: endo-beta-N-acetylglucosaminidase Calculated Molecular Weight: 84 kDa GenBank Accession Number: NM_001042573 Gene Symbol: ENGASE Gene ID (NCBI): 64772 RRID: AB_3670113 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8NFI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.