Proteintech, 31788-1-AP, TRBC1 Polyclonal antibody

Size: 20ul / 150ul The TRBC1 (31788-1-AP) by Proteintech is a Polyclonal antibody targeting TRBC1 in WB, ELISA applications with reactivity to human samples 31788-1-AP targets TRBC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuT 78 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TRBC1 (T-cell receptor beta constant 1) is a protein encoded by the TRBC1 gene. It constitutes one of the two beta-chain constant regions (TRBC1 and TRBC2) within the T-cell receptor (TCR) complex, which is essential for adaptive immune responses . Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35434 Product name: Recombinant human TRBC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of M12888 Sequence: DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYE Predict reactive species Full Name: T cell receptor beta constant 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: M12888 Gene Symbol: TRBC1 Gene ID (NCBI): 28639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01850 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.